CDS

Accession Number TCMCG032C05397
gbkey CDS
Protein Id OVA09912.1
Location complement(join(713524..713625,713719..713805,713980..714044,714839..714920,716105..716242))
Organism Macleaya cordata
locus_tag BVC80_1751g68

Protein

Length 157aa
Molecule type protein
Topology linear
Data_file_division PLN
dblink BioProject:PRJNA359127, BioSample:SAMN06209354
db_source MVGT01002043.1
Definition ATPase [Macleaya cordata]
Locus_tag BVC80_1751g68

EGGNOG-MAPPER Annotation

COG_category C
Description Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha(3)beta(3) subcomplex and subunit a ATP6 static relative to the rotary elements
KEGG_TC 3.A.2.1
KEGG_Module M00158        [VIEW IN KEGG]
KEGG_Reaction -
KEGG_rclass -
BRITE ko00000        [VIEW IN KEGG]
ko00001        [VIEW IN KEGG]
ko00002        [VIEW IN KEGG]
KEGG_ko ko:K02138        [VIEW IN KEGG]
EC -
KEGG_Pathway ko00190        [VIEW IN KEGG]
ko01100        [VIEW IN KEGG]
ko04714        [VIEW IN KEGG]
ko05010        [VIEW IN KEGG]
ko05012        [VIEW IN KEGG]
ko05016        [VIEW IN KEGG]
map00190        [VIEW IN KEGG]
map01100        [VIEW IN KEGG]
map04714        [VIEW IN KEGG]
map05010        [VIEW IN KEGG]
map05012        [VIEW IN KEGG]
map05016        [VIEW IN KEGG]
GOs -

Sequence

CDS:  
ATGAGTGGGGCGGGGAAGAAGATTGCAGATGTGGCTGTAAAGGCATCAAAGGGAATCGATTGGGATGGAATGGCTAAGCTTCTTGTTACAGAGGAGGCTCGCAAGGAGTTCGCTACTCTTCGCCGAGCTTTCGATGAGGAGCCTGAACCCATAGATTGGGAGTACTATAGAAAAGGAATTGGCCCTCGCTTGGTGGATATGTACAAGGAGGCTTATGATAGTATTCAGATCCCCAAGTTTGTAGACACTGTGACTCCTCAATACAAACCGAAGTTTGATGCACTGGTTGTGGAACTGAAAGAAGCAGAACAGAAATCACTCAAGGAGTCCGAGAGACTGGACAAGGAAATTGCTGAAGTCCAAGAGATGAAGCTAAAGATCAGCACCATGACGGCAAATGAATACTTTGAGAAGCATCCCGAGTTGAAGAAGAAGTTCGATGACGAAATCAGGAATGATTATTGGGGTTATTGA
Protein:  
MSGAGKKIADVAVKASKGIDWDGMAKLLVTEEARKEFATLRRAFDEEPEPIDWEYYRKGIGPRLVDMYKEAYDSIQIPKFVDTVTPQYKPKFDALVVELKEAEQKSLKESERLDKEIAEVQEMKLKISTMTANEYFEKHPELKKKFDDEIRNDYWGY